PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g080740.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 148aa    MW: 17265.3 Da    PI: 8.4145
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g080740.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.82.4e-132785563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        ++ +r+q+NRe+ArrsR RK++ ++ L   v +L++eN+   + + + ++++ ++++e+
  Sopim04g080740.0.1 27 RKRKRMQSNRESARRSRMRKQKHLDDLMCQVTQLKKENSNILNSITMTTQQYGNVEAEN 85
                        5789***********************************99999999999988887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-192387IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.8752588IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-112580No hitNo description
PfamPF001704.1E-102778IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-122778No hitNo description
CDDcd147024.76E-192878No hitNo description
PROSITE patternPS0003603045IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MATSSGNSSQ IPNNSASDEV FMVVDERKRK RMQSNRESAR RSRMRKQKHL DDLMCQVTQL  60
KKENSNILNS ITMTTQQYGN VEAENSVLRA QMMELTQRLQ SLNEILTYIN NSNNNNNYYQ  120
EDFQMNPWNL MYVNQPIMAS SDMLYQY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12647RKRKRMQSNRESARRSRMRKQK
23946RRSRMRKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238299.11e-104PREDICTED: ocs element-binding factor 1
SwissprotQ9LZP84e-31BZP53_ARATH; bZIP transcription factor 53
TrEMBLK4BVF31e-104K4BVF3_SOLLC; Uncharacterized protein
STRINGSolyc04g080740.1.11e-104(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53724123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-46basic leucine-zipper 44